PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E00175.1.p
Common NameEUGRSUZ_E00175, LOC104443463
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 299aa    MW: 32982.9 Da    PI: 5.7341
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E00175.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+d++ + G g+W+  ++  g+ R++k+c++rw +yl
  Eucgr.E00175.1.p 14 KGPWTPEEDQILIDYISKNGHGSWRVLPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding43.66.7e-1467112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ +E++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
  Eucgr.E00175.1.p  67 RGSFSLQEEKLVIQLHGILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                       899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.671965IPR017930Myb domain
SuperFamilySSF466894.87E-2911108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002498.9E-161461IPR001005SANT/Myb domain
CDDcd001676.59E-111661No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.28466116IPR017930Myb domain
SMARTSM007178.2E-1366114IPR001005SANT/Myb domain
PfamPF002494.4E-1367112IPR001005SANT/Myb domain
CDDcd001672.13E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRSPCCERK DLKKGPWTPE EDQILIDYIS KNGHGSWRVL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGSF SLQEEKLVIQ LHGILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLLSTG  120
LNPLTQDPFS PQGSMTKLPA SSITRHMAQW ESARLEAEAR LSRETLLLNT LPLQQKTDGD  180
YFLRVWNSEV GESFRSINRR SKSASLSAVS QASSCAECET SSVATIEIGT TYLGADADST  240
PNDHDNDADG KSSGAEYEAL ATSEYSGSSE FDSSTVTALE MLFDFPIDND MSFLEGSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31111164108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E00175.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055169.10.0PREDICTED: myb-related protein 340-like isoform X1
RefseqXP_010055170.10.0PREDICTED: myb-related protein 340-like isoform X2
RefseqXP_010055171.10.0PREDICTED: myb-related protein 340-like isoform X2
TrEMBLA0A059BZU30.0A0A059BZU3_EUCGR; Uncharacterized protein
STRINGVIT_15s0046g03190.t011e-128(Vitis vinifera)
STRINGPOPTR_0014s07700.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-112myb domain protein 17